Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7UZM6

Expression Region

1-123

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELDGFIYILVGSTFGLIVRMFIKYISGKKKIFYSNNILIVNVLASLFLGIFEGLNITNK NLILFIFVGFLGCFSTFSSFIYQLFNLIREKKYLILLIYYAEVILLSFLFFCLGYFITLT FIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRODH2 antibody - C-terminal region (ARP41621_P050)
ARP41621_P050 100 µL

PRODH2 antibody - C-terminal region (ARP41621_P050)

Sign In for Pricing
View Details
Rabbit Bladder Stromal Fibroblasts (BSF)
abx700109 5x 10^5 Cells

Rabbit Bladder Stromal Fibroblasts (BSF)

Sign In for Pricing
View Details
Tlr1 Mouse Gene Knockout Kit (CRISPR)
KN517621 1 Kit

Tlr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hex-5' 50 nmol scale
26-6432-05 1 Each

Hex-5' 50 nmol scale

Sign In for Pricing
View Details
CPLX3 Antibody
orb2682095-01 50 µL

CPLX3 Antibody

Sign In for Pricing
View Details
CPLX3 Antibody
orb2682095-02 100 µL

CPLX3 Antibody

Sign In for Pricing
View Details