Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7UZM6

Expression Region

1-123

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELDGFIYILVGSTFGLIVRMFIKYISGKKKIFYSNNILIVNVLASLFLGIFEGLNITNK NLILFIFVGFLGCFSTFSSFIYQLFNLIREKKYLILLIYYAEVILLSFLFFCLGYFITLT FIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurogranin (NRGN) (NM_001126181) Human Untagged Clone
SC322795 10 µg

Neurogranin (NRGN) (NM_001126181) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC27 Antibody
NBP2-62655-25ul 25 µL

Rabbit Polyclonal LRRC27 Antibody

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2140888-01 0.1 mL

HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2140888-02 0.2 mL

HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2140888-03 0.5 mL

HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2140888-04 1 mL

HRP-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details