Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus megaterium ATP synthase protein I (atpI)

This Recombinant Bacillus megaterium ATP synthase protein I (atpI) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P20598

Expression Region

1-123

Origin

Bacillus megaterium (strain ATCC 12872 / QMB1551)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQDLQHVFPRLRSYILYLLALYVLGWGFTSYKAVFAGLILGTALSLYNLWNLVRKFEQFG QALDEGKKPRSIGTVVRFATAALAVVITISYPKTFHIISVVVGLMTYYVVIIIDLVVQNM RRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-100 1x 100 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF740 conjugate, 0.1mg/mL
BNC740461-100 1x 100 µL

Chromogranin A (PHE5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details