Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q46IH7

Expression Region

1-124

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDILFVSIGAILGANIRFQIHHKLGNLNLDKGFLILIINTFASFGLGLFLSLVEQFRAF TYSYQLILFFSIGFFGSLSTFSSFVYDLFDLCLQLELFRALKLFIISVSIGIIAFAFGLF LGTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRTG Protein Vector (Mouse) (pPB-N-His)
PV220151 500 ng

PRTG Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Amidophosphoribosyltransferase (ade4), partial
MBS1023838 Inquire

Recombinant Schizosaccharomyces pombe Amidophosphoribosyltransferase (ade4), partial

Sign In for Pricing
View Details
RNF190 Polyclonal Antibody, APC Conjugated
bs-9245R-APC 100 µL

RNF190 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Seasonal H1N1 Neuraminidase Antibody [DyLight 594]
NBP2-41111DL594 0.1 mL

Rabbit Polyclonal Seasonal H1N1 Neuraminidase Antibody [DyLight 594]

Sign In for Pricing
View Details
STS Antibody - C-terminal region : HRP (ARP41710_T100-HRP)
ARP41710_T100-HRP 100 µL

STS Antibody - C-terminal region : HRP (ARP41710_T100-HRP)

Sign In for Pricing
View Details
Lysosomal Intracellular Activity Assay Kit
EGN0106 50 Tests

Lysosomal Intracellular Activity Assay Kit

Sign In for Pricing
View Details