Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q46IH7

Expression Region

1-124

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDILFVSIGAILGANIRFQIHHKLGNLNLDKGFLILIINTFASFGLGLFLSLVEQFRAF TYSYQLILFFSIGFFGSLSTFSSFVYDLFDLCLQLELFRALKLFIISVSIGIIAFAFGLF LGTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human coxiella burnetii Q fever phase 2 (Q fever) antibody (IgM) (Q fever IgM) ELISA Kit
EIA07596h 1 Kit

Human coxiella burnetii Q fever phase 2 (Q fever) antibody (IgM) (Q fever IgM) ELISA Kit

Sign In for Pricing
View Details
PACSIN2 Human Over-expression Lysate
orb1367730 20 µg

PACSIN2 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Wnt-4 MAb (Clone 55010)
MAB475-500 500 µg

Mouse Wnt-4 MAb (Clone 55010)

Sign In for Pricing
View Details
Recombinant Varicella-zoster virus Alkaline nuclease (ORF48), partial
MBS1453114 Inquire

Recombinant Varicella-zoster virus Alkaline nuclease (ORF48), partial

Sign In for Pricing
View Details
Rabbit Protein Carbonyl ELISA Kit
GTR10478440-01 48 Well

Rabbit Protein Carbonyl ELISA Kit

Sign In for Pricing
View Details
Rabbit Protein Carbonyl ELISA Kit
GTR10478440-02 96 Well

Rabbit Protein Carbonyl ELISA Kit

Sign In for Pricing
View Details