Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 1 (crcB1)

This Recombinant Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q67S17

Expression Region

1-124

Origin

Symbiobacterium thermophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWVLIGVAGAAGAVARLLVGAWIDGRPGGRAFPWGTFAVNIAGSLLLGLLTGLVVGRGW LAPEVKVVLGAGFLGAFTTFSTWLLDLHEALRRGDHRAAFVNAALSTGLGLLAAWLGLAL GWGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details