Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7V937

Expression Region

1-124

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANPTQPLPNQWNEMWLVAFGAVPGALVRWQVQNDLLVNVIGAAILGLVVGLPFRPSRQL LLGVGFCGSLTTFSSWMVECSTLISQGAWLSALGLIGLTMGLGLGVAALGFLIGWQFRPS GLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig P-Selectin (SELP) ELISA Kit
abx255564 96 Well

Pig P-Selectin (SELP) ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 2D6, Recombinant, Human (CYP2D6) discontinued
C9095-15K2-01 5 µg

Cytochrome P450 2D6, Recombinant, Human (CYP2D6) discontinued

Sign In for Pricing
View Details
Cytochrome P450 2D6, Recombinant, Human (CYP2D6) discontinued
C9095-15K2-02 20 µg

Cytochrome P450 2D6, Recombinant, Human (CYP2D6) discontinued

Sign In for Pricing
View Details
Olr421 Protein Vector (Rat) (pPM-C-His)
PV289993 500 ng

Olr421 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
MAL2 Antibody
DF14069-01 100 µL

MAL2 Antibody

Sign In for Pricing
View Details
MAL2 Antibody
DF14069-02 200 µL

MAL2 Antibody

Sign In for Pricing
View Details