Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7V937

Expression Region

1-124

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANPTQPLPNQWNEMWLVAFGAVPGALVRWQVQNDLLVNVIGAAILGLVVGLPFRPSRQL LLGVGFCGSLTTFSSWMVECSTLISQGAWLSALGLIGLTMGLGLGVAALGFLIGWQFRPS GLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSK1 p90 Antibody (YA088, Rabbit)
HY-P80315-01 10 µL

RSK1 p90 Antibody (YA088, Rabbit)

Sign In for Pricing
View Details
RSK1 p90 Antibody (YA088, Rabbit)
HY-P80315-02 50 μL

RSK1 p90 Antibody (YA088, Rabbit)

Sign In for Pricing
View Details
RSK1 p90 Antibody (YA088, Rabbit)
HY-P80315-03 100 µL

RSK1 p90 Antibody (YA088, Rabbit)

Sign In for Pricing
View Details
Lupus La protein Polyclonal Antibody
42333 100 µg

Lupus La protein Polyclonal Antibody

Sign In for Pricing
View Details
Mouse POSTN (Periostin) ELISA Kit
ELK10803-01 48 Tests

Mouse POSTN (Periostin) ELISA Kit

Sign In for Pricing
View Details
Mouse POSTN (Periostin) ELISA Kit
ELK10803-02 96 Tests

Mouse POSTN (Periostin) ELISA Kit

Sign In for Pricing
View Details