Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis UPF0344 protein OB1184 (OB1184)

This Recombinant Oceanobacillus iheyensis UPF0344 protein OB1184 (OB1184) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

UPF0344 protein OB1184

UniProt

Q8ERW3

Expression Region

1-124

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHMHITSWALGLILFIIALVMYKKGNQKPAKIIHMILRLMFILIIITGGILTWDYIQGY GMPILGEALVKALAGLWLVAMMEMILTGKAKGKPTTAKWVQFSIALVLVIVLGFFRLPMG FLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details