Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase protein I (atpI)

This Recombinant ATP synthase protein I (atpI) spans the amino acid sequence from region 2-126.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P0ABC1

Expression Region

2-126

Origin

Escherichia coli O6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRH QAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAV INNKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Afatinib impurity 36
HY-Z2264-01 5 mg

Afatinib impurity 36

Sign In for Pricing
View Details
Afatinib impurity 36
HY-Z2264-02 10 mg

Afatinib impurity 36

Sign In for Pricing
View Details
Afatinib impurity 36
HY-Z2264-03 25 mg

Afatinib impurity 36

Sign In for Pricing
View Details
Afatinib impurity 36
HY-Z2264-04 50 mg

Afatinib impurity 36

Sign In for Pricing
View Details
NKX3.2 Antibody
F45860-0.08ML 0.08 mL

NKX3.2 Antibody

Sign In for Pricing
View Details
Vitamin A Acetate (Retinyl Acetate) for tissue culture
14553-01 5 g

Vitamin A Acetate (Retinyl Acetate) for tissue culture

Sign In for Pricing
View Details