Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase protein I (atpI)

This Recombinant ATP synthase protein I (atpI) spans the amino acid sequence from region 2-126.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P0ABC1

Expression Region

2-126

Origin

Escherichia coli O6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRH QAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAV INNKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Microalbumin (MALB) ELISA
KBH13218 1x 96 Well

GENLISA Human Microalbumin (MALB) ELISA

Sign In for Pricing
View Details
Chicken Glutathione S-transferase Mu 1 ELISA Kit
MBS014255-01 48 Well

Chicken Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details
Chicken Glutathione S-transferase Mu 1 ELISA Kit
MBS014255-02 96 Well

Chicken Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details
Chicken Glutathione S-transferase Mu 1 ELISA Kit
MBS014255-03 5x 96 Well

Chicken Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details
Chicken Glutathione S-transferase Mu 1 ELISA Kit
MBS014255-04 10x 96 Well

Chicken Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 NL63 Recombinant protein Liquid 100UG
ICOV2NL63R100UG 100 µg

SARS-CoV-2 NL63 Recombinant protein Liquid 100UG

Sign In for Pricing
View Details