Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

This Recombinant Salmonella paratyphi A Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF, L-Ara4N-phosphoundecaprenol flippase subunit ArnF, Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF

UniProt

B5BCP2

Expression Region

1-125

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVMWGLISVAIASLAQLSLGFAMMRLPSIAHPLAFISGLGAFNAATLALFAGLAGYLVS VFCWQKTLHMLALSKAYALLSLSYVLVWVASMLLPGLQGAFSLKAMLGVLCIMAGVMLIF LPARS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Psmd4 ELISA KIT
ELI-44838m 96 Tests

Mouse Psmd4 ELISA KIT

Sign In for Pricing
View Details
Mouse IL-25 ELISA Kit
SEKM-0026-01 48 Tests

Mouse IL-25 ELISA Kit

Sign In for Pricing
View Details
Mouse IL-25 ELISA Kit
SEKM-0026-02 96 Tests

Mouse IL-25 ELISA Kit

Sign In for Pricing
View Details
NCC-RbC-51
ABC-TC0732 1 Vial

NCC-RbC-51

Sign In for Pricing
View Details
NKX1-1 Rabbit Polyclonal Antibody (BF594)
orb2471153 100 µL

NKX1-1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Research Grade Anti-Human CD171/L1CAM (JCAR023)
HB159016-01 100 µg

Research Grade Anti-Human CD171/L1CAM (JCAR023)

Sign In for Pricing
View Details