Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani Protein CrcB homolog (crcB)

This Recombinant Nitrosococcus oceani Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q3J8V3

Expression Region

1-125

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWQKLAWIALAGAGGTLSRYALSGLVQNLCGASFPWGTWVVNGLGCFLFGMIWALAEERL LITGEIRFIVLTGFMGAFTTFSTFAFEASQFLRDSEWLLAAIHLIGQNSLGLVCVFLGFT ISQII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal UBR2 Antibody (PCRP-UBR2-1D12) [FITC]
NBP3-14287F 0.1 mL

Mouse Monoclonal UBR2 Antibody (PCRP-UBR2-1D12) [FITC]

Sign In for Pricing
View Details
PPA2 Human Over-expression Lysate
orb1343387 100 µg

PPA2 Human Over-expression Lysate

Sign In for Pricing
View Details
Human DYSF Knockout A549 cell line
GTR15409472 1 Vial

Human DYSF Knockout A549 cell line

Sign In for Pricing
View Details
4- (1,3-Oxazol-5-yl) benzonitrile
OR24050-01 1 g

4- (1,3-Oxazol-5-yl) benzonitrile

Sign In for Pricing
View Details
4- (1,3-Oxazol-5-yl) benzonitrile
OR24050-02 5 g

4- (1,3-Oxazol-5-yl) benzonitrile

Sign In for Pricing
View Details
Recombinant Rat Protein FAM210A (Fam210a)
MBS7014581-01 0.02 mg

Recombinant Rat Protein FAM210A (Fam210a)

Sign In for Pricing
View Details