Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

This Recombinant Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF, L-Ara4N-phosphoundecaprenol flippase subunit ArnF, Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF

UniProt

Q8Z537

Expression Region

1-125

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVMWGLISVAIASLAQLSLGFAMMRLPSIAHPLAFISGLGAFNAATLALFAGLAGYLVS VFCWQKTLHMLALSKAYALLSLSYVLVWVASMLLPGLQGAFSLKAMLGVLCIMAGVMLIF LPARS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL
BNC881137-100 1x 100 µL

ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF405S conjugate, 0.1mg/mL
BNC042208-500 1x 500 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF647 conjugate, 0.1mg/mL
BNC470818-500 1x 500 µL

CD45RA (PTPRC/818), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF594 conjugate, 0.1mg/mL
BNC940021-100 1x 100 µL

Cytokeratin 18 (DC10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details