Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marinobacter aquaeolei Protein CrcB homolog (crcB)

This Recombinant Marinobacter aquaeolei Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A1U6R3

Expression Region

1-126

Origin

Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWSVLAVSVGAVIGANLRWGLGLWLNASYHAVPWGTLVANLSGGWLIGVLMAFFSQSSV LSPEWRLFAVTGLCGALTTFSTFSLEMFAALQEGKWGMALVGILAHVVGSILMTALGFLT FSLVRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF594 conjugate, 0.1mg/mL
BNC941147-500 1x 500 µL

CD45RB (PTPRC/1147), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF568 conjugate, 0.1mg/mL
BNC680764-100 1x 100 µL

CD79a (IGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040385-500 1x 500 µL

CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details