Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protein CrcB homolog (crcB)

This Recombinant Acinetobacter baumannii Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B2I2S5

Expression Region

1-126

Origin

Acinetobacter baumannii (strain ACICU)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYYPLLSIALGSVLGAWLRWLLGLKLNPIYPQIPLGTVTVNLAGGFIIGFAMAYFAHSDL SPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISIHLIGSLIFTCLGLATY YWVAGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bempedoic Acid
TRC-B119700-25MG 25 mg

Bempedoic Acid

Sign In for Pricing
View Details
iFluor™ 488 Conjugated E-Cadherin Recombinant Rabbit Monoclonal Antibody [SY0287]
HA720159F 100 µL

iFluor™ 488 Conjugated E-Cadherin Recombinant Rabbit Monoclonal Antibody [SY0287]

Sign In for Pricing
View Details
CF®594-dUTP, Lyophilized Powder
#40006-T 1x 5 nmol

CF®594-dUTP, Lyophilized Powder

Sign In for Pricing
View Details
Recombinant Prealbumin/Transthyretin Monoclonal Antibody
AN302048L-01 50 µL

Recombinant Prealbumin/Transthyretin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Prealbumin/Transthyretin Monoclonal Antibody
AN302048L-02 100 µL

Recombinant Prealbumin/Transthyretin Monoclonal Antibody

Sign In for Pricing
View Details
Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL
BNCB0096-100 1x 100 µL

Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details