Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protein CrcB homolog (crcB)

This Recombinant Acinetobacter baumannii Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B2I2S5

Expression Region

1-126

Origin

Acinetobacter baumannii (strain ACICU)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYYPLLSIALGSVLGAWLRWLLGLKLNPIYPQIPLGTVTVNLAGGFIIGFAMAYFAHSDL SPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISIHLIGSLIFTCLGLATY YWVAGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPSAP1 (NM_002766) Human Recombinant Protein
TP303779M 100 µg

PRPSAP1 (NM_002766) Human Recombinant Protein

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), CF647 conjugate, 0.1mg/mL
BNC470670-100 1x 100 µL

CD66 (CEA) (CEA31), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RGS19 (NM_005873) Human Recombinant Protein
TP309082M 100 µg

RGS19 (NM_005873) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details