Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodospirillum centenum Protein CrcB homolog (crcB)

This Recombinant Rhodospirillum centenum Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B6IQX6

Expression Region

1-126

Origin

Rhodospirillum centenum (strain ATCC 51521 / SW)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMILAVAAGGGLGAVARYLTGVGLGHWLGTAYPWATMTVNVTGSFAMGVLAGLGAHVWQ PAPELRAFLMVGVLGGFTTFSSFSLDVALLVERGAIGAAAAYVAASFLLSVGGLFAGLAL IRTAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-500 1x 500 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details