Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protein CrcB homolog (crcB)

This Recombinant Acinetobacter baumannii Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B7H0W5

Expression Region

1-126

Origin

Acinetobacter baumannii (strain AB307-0294)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYYPLLSIALGSVLGAWLRWFLGLKLNPIYPQIPLGTVTVNLVGGFIIGFAMAYFAHSDL NPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISIHLIGSLIFTCLGLATY YWVAGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF405S conjugate, 0.1mg/mL
BNC042877-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF488A conjugate, 0.1mg/mL
BNC882046-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details