Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus geothermalis Protein CrcB homolog 1 (crcB1)

This Recombinant Deinococcus geothermalis Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q1J232

Expression Region

1-126

Origin

Deinococcus geothermalis (strain DSM 11300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKAGLWLWLMLGGAVGAVCRQGVVLALAPLVARLGFPVAVLGINVLGSFLLGLTLALAGR GVWPPEVRVAFGTGVLGAFTTFSTFSTELDELLGRGAVGLAALYAGLSVGLGLLAAVAGR LLGTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL
BNC881148-500 1x 500 µL

CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF405S conjugate, 0.1mg/mL
BNC040822-100 1x 100 µL

P21 / WAF1 (DCS-60.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (ECM1/792), CF405S conjugate, 0.1mg/mL
BNC040792-100 1x 100 µL

IgA Secretory Component (ECM1/792), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details