Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter hamburgensis Protein CrcB homolog 1 (crcB1)

This Recombinant Nitrobacter hamburgensis Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q1QRN0

Expression Region

1-126

Origin

Nitrobacter hamburgensis (strain X14 / DSM 10229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWTFILAVAAGGSLGSVARYLVGIGFGRLLGPKFPWGTLFINITGSLLIGLFAGLFAIR WNLPQAVRIFLIVGICGGYTTFSTFSLDSFYLIERGEVAAAGAYMIASVVLSVGALIAGI QIVRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Rabbit PAb), CF647 conjugate, 0.1mg/mL
BNC470731-500 1x 500 µL

AMACR / p504S (Rabbit PAb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF640R conjugate, 0.1mg/mL
BNC402408-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF568 conjugate, 0.1mg/mL
BNC681790-500 1x 500 µL

CD79a (B-Cell Marker) (IGA/1790R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details