Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella avium Protein CrcB homolog (crcB)

This Recombinant Bordetella avium Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q2KXU0

Expression Region

1-126

Origin

Bordetella avium (strain 197N)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVPLHFLAVGVGAAAGAWLRWLLGLKFNVSGWPWGTLAANLGGGYLIGLILGLITLHPE WPAWVRLALVTGFLGGLTTFSTFSAEVVQYLERGQFGHAAGYAVVSLAGSLCLTALGLAT AHLMGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL
BNC740782-100 1x 100 µL

Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF740 conjugate, 0.1mg/mL
BNC740563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details