Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus PS3 ATP synthase protein I (atpI)

This Recombinant Bacillus PS3 ATP synthase protein I (atpI) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P09354

Expression Region

1-127

Origin

Bacillus PS3 (Thermophilic bacterium PS-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNLQAMFWRQVRYILYLLAIYTLGFGFTPYKTVFLSLILGTSISLLMVWNLTWKIEKFG QAVAARKKVRTLGTLSRLALAALAAVIVLTYPQYFHIVPTVLGLMTSYIVIIIDFFFHKW KNDKLQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HJC0152 hydrochloride
T4234-01 1 mg

HJC0152 hydrochloride

Sign In for Pricing
View Details
HJC0152 hydrochloride
T4234-02 2 mg

HJC0152 hydrochloride

Sign In for Pricing
View Details
HJC0152 hydrochloride
T4234-03 5 mg

HJC0152 hydrochloride

Sign In for Pricing
View Details
HJC0152 hydrochloride
T4234-04 10 mg

HJC0152 hydrochloride

Sign In for Pricing
View Details
HJC0152 hydrochloride
T4234-05 25 mg

HJC0152 hydrochloride

Sign In for Pricing
View Details
HJC0152 hydrochloride
T4234-06 50 mg

HJC0152 hydrochloride

Sign In for Pricing
View Details