Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein CrcB homolog (crcB)

This Recombinant Salmonella paratyphi A Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B5BCG4

Expression Region

1-127

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF594 conjugate, 0.1mg/mL
BNC942145-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF488A conjugate, 0.1mg/mL
BNC881071-100 1x 100 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF740 conjugate, 0.1mg/mL
BNC742980-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF488A conjugate, 0.1mg/mL
BNC881957-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details