Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 1 (crcB1)

This Recombinant Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q66DF7

Expression Region

1-127

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNTLLAVFIGGGVGSMARWLVSLKLNSASAHLPVGTLIVNLVGAFIIGLTLALFSRMTH IDPVWKLLITTGFCGGLTTFSTFSVEVVYLIQEGKLTWAAGTILLNVAGSLAMTMLAFIL VNNFASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details