Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ywcD

UniProt

P39602

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIIMGVFTTIVNIASFYILVEIMNVDYKAATVAAWILSVLFAYITNKLYVFQQKTHDLQ SLLKELTAFFSVRVLSLGIDLGMMIILVGQFNTNETLAKILDNAVIVVVNYVASKWLVFK KTKEEGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Z) -1,2-Diphenyl-1- (4-hydroxyphenyl) -1-butene (contains up to 10% E-isomer)
sc-497124 100 mg

(Z) -1,2-Diphenyl-1- (4-hydroxyphenyl) -1-butene (contains up to 10% E-isomer)

Sign In for Pricing
View Details
Recombinant Human Zfp-90 (C-His)
32-10884-50 50 µg

Recombinant Human Zfp-90 (C-His)

Sign In for Pricing
View Details
Serpinb6b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6443207 1.0 µg DNA

Serpinb6b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Anti-CHRNB3 antibody
STJ71568 100 µg

Anti-CHRNB3 antibody

Sign In for Pricing
View Details
Aluminium Powder -100 mesh, 99.7%
GX6483-100g 100 g

Aluminium Powder -100 mesh, 99.7%

Sign In for Pricing
View Details
ITPRIPL1 Protein (C-His, Human)
P526098 100 µg

ITPRIPL1 Protein (C-His, Human)

Sign In for Pricing
View Details