Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Protein CrcB homolog (crcB)

This Recombinant Haemophilus influenzae Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q4QMV0

Expression Region

1-128

Origin

Haemophilus influenzae (strain 86-028NP)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQALLFISYGAILGASLRWAIGLLFNPLFSSFAFGTLIANLLGCLIIGVLLGFFWQFPQI SSEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIY KICSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-100 1x 100 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF640R conjugate, 0.1mg/mL
BNC400798-500 1x 500 µL

Chromogranin A (CHGA/798), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details