Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Holin-like protein CidA (cidA)

This Recombinant Bacillus subtilis Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P39591

Expression Region

1-128

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLLLTVIQIALLFIFARLINWVTALLHINIPGSIIGIVILFTLLHFNIIKLEWIELGA AWLLGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVIISTFVVMVSTGTLTQLIAKRKEK KHTCSSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2Z-Nalfurafine
TRC-N255610-5MG 5 mg

2Z-Nalfurafine

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF488A conjugate, 0.1mg/mL
BNC882318-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CAPN15 Polyclonal Antibody
E-AB-17763-01 20 µL

CAPN15 Polyclonal Antibody

Sign In for Pricing
View Details
CAPN15 Polyclonal Antibody
E-AB-17763-02 60 µL

CAPN15 Polyclonal Antibody

Sign In for Pricing
View Details
CAPN15 Polyclonal Antibody
E-AB-17763-03 120 µL

CAPN15 Polyclonal Antibody

Sign In for Pricing
View Details
CAPN15 Polyclonal Antibody
E-AB-17763-04 200 µL

CAPN15 Polyclonal Antibody

Sign In for Pricing
View Details