Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Holin-like protein CidA (cidA)

This Recombinant Bacillus subtilis Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P39591

Expression Region

1-128

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLLLTVIQIALLFIFARLINWVTALLHINIPGSIIGIVILFTLLHFNIIKLEWIELGA AWLLGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVIISTFVVMVSTGTLTQLIAKRKEK KHTCSSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF2C3
Y158416 100 µL

Anti-EIF2C3

Sign In for Pricing
View Details
FAT4 Human Gene Knockout Kit (CRISPR)
KN420240 1 Kit

FAT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS642033 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
rac Kynurenine
TRC-K661000-25MG 25 mg

rac Kynurenine

Sign In for Pricing
View Details
beta Defensin 3 (DEFB103A) (NM_001081551) Human Over-expression Lysate
LY421161 100 µg

beta Defensin 3 (DEFB103A) (NM_001081551) Human Over-expression Lysate

Sign In for Pricing
View Details
Microbiological Spreaders
M5421 500 Units/Pack

Microbiological Spreaders

Sign In for Pricing
View Details