Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP)

This Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Uncharacterized protein ycbP, ORF15

UniProt

P42248

Expression Region

1-128

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMI ATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKH YLETRTDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Interleukin 32 Alpha ELISA kit
GTR10401384 96 Well

Rabbit Interleukin 32 Alpha ELISA kit

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) ERG1 Polyclonal Antibody
MBS7189093 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) ERG1 Polyclonal Antibody

Sign In for Pricing
View Details
RAB4B CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38353156 3x 1.0 µg DNA

RAB4B CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Gm10487 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
21702114 3x 1.0 µg

Gm10487 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
HRSP12 Rabbit pAb
A4392-01 20 µL

HRSP12 Rabbit pAb

Sign In for Pricing
View Details
HRSP12 Rabbit pAb
A4392-02 100 μL

HRSP12 Rabbit pAb

Sign In for Pricing
View Details