Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP)

This Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Uncharacterized protein ycbP, ORF15

UniProt

P42248

Expression Region

1-128

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMI ATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKH YLETRTDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC-8A HDR Plasmid (h)
sc-412946-HDR 20 µg

RIC-8A HDR Plasmid (h)

Sign In for Pricing
View Details
Nisch Mouse siRNA Oligo Duplex (Locus ID 64652)
SR423046 1 Kit

Nisch Mouse siRNA Oligo Duplex (Locus ID 64652)

Sign In for Pricing
View Details
Rad52 ORF Vector (Mouse) (pORF)
ORF055506 1.0 µg DNA

Rad52 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
INS sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
24989111 3x 1.0 µg

INS sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RAB37 (NM_001163989) Human Tagged Lenti ORF Clone
RC228161L4 10 µg

RAB37 (NM_001163989) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CA229 Rabbit Polyclonal Antibody
BT-AP06758-01 20 µL

CA229 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details