Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP)

This Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Uncharacterized protein ycbP, ORF15

UniProt

P42248

Expression Region

1-128

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMI ATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKH YLETRTDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oas1a Protein Vector (Mouse) (pPM-C-HA)
32386024 500 ng

Oas1a Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human EFCAB13 siRNA
abx914998-01 15 nmol

Human EFCAB13 siRNA

Sign In for Pricing
View Details
Human EFCAB13 siRNA
abx914998-02 30 nmol

Human EFCAB13 siRNA

Sign In for Pricing
View Details
RPS24 CytoSection
TS426724P5 25 Slides

RPS24 CytoSection

Sign In for Pricing
View Details
Fish Prolactin (PRL) ELISA Kit
MBS9940634 Inquire

Fish Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
PHKG1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36595111 3x 1.0 µg

PHKG1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details