Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sirB2 (sirB2)

This Recombinant Protein sirB2 (sirB2) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Protein sirB2

UniProt

P0A238

Expression Region

1-129

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAMLLTLHLICVALSVSLFVARYWWRYCGHALAAARWTRIVPPVIDTLLLLSGIGLIV KTHILPFTESGSWLTEKLFGVIIYIVLGFIALDYRQARSQQARFIAFPLALVVLYIIIKL ATTKIPLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VTCN1/B7-H4 (AZD8205) Biosimilar (Monoclonal, IgG)
A135746 100 µL

Anti-VTCN1/B7-H4 (AZD8205) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
ACVR1 Conjugated Antibody
MBS9451888-01 0.1 mL (Biotin)

ACVR1 Conjugated Antibody

Sign In for Pricing
View Details
ACVR1 Conjugated Antibody
MBS9451888-02 0.1 mL (AF350)

ACVR1 Conjugated Antibody

Sign In for Pricing
View Details
ACVR1 Conjugated Antibody
MBS9451888-03 0.1 mL (AF405)

ACVR1 Conjugated Antibody

Sign In for Pricing
View Details
ACVR1 Conjugated Antibody
MBS9451888-04 0.1 mL (AF488)

ACVR1 Conjugated Antibody

Sign In for Pricing
View Details
ACVR1 Conjugated Antibody
MBS9451888-05 0.1 mL (AF555)

ACVR1 Conjugated Antibody

Sign In for Pricing
View Details