Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sirB2 (sirB2)

This Recombinant Protein sirB2 (sirB2) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Protein sirB2

UniProt

P0A238

Expression Region

1-129

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAMLLTLHLICVALSVSLFVARYWWRYCGHALAAARWTRIVPPVIDTLLLLSGIGLIV KTHILPFTESGSWLTEKLFGVIIYIVLGFIALDYRQARSQQARFIAFPLALVVLYIIIKL ATTKIPLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLBP (NM_006527) Human Over-expression Lysate
LS007884-100ug 100 µg

SLBP (NM_006527) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CK-Mb McAb
orb1993857 1 mg

Anti-CK-Mb McAb

Sign In for Pricing
View Details
NUDC (Nuclear Distribution Gene C Homolog (A. nidulans), HNUDC, MNUDC, NPD011) (MaxLight 490)
249530-ML490 100 µL

NUDC (Nuclear Distribution Gene C Homolog (A. nidulans), HNUDC, MNUDC, NPD011) (MaxLight 490)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Tryptase (TPS)
MBS2132294-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Tryptase (TPS)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Tryptase (TPS)
MBS2132294-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Tryptase (TPS)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Tryptase (TPS)
MBS2132294-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Tryptase (TPS)

Sign In for Pricing
View Details