Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SaurJH1_0988 (SaurJH1_0988)

This Recombinant Staphylococcus aureus UPF0344 protein SaurJH1_0988 (SaurJH1_0988) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SaurJH1_0988

UniProt

A6U076

Expression Region

1-129

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-100 1x 100 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF488A conjugate, 0.1mg/mL
BNC880688-500 1x 500 µL

Cytokeratin 8 (C-43), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF568 conjugate, 0.1mg/mL
BNC682156-500 1x 500 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF568 conjugate, 0.1mg/mL
BNC682970-500 1x 500 µL

MUC2 (Mucin 2) (MLP/2970R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details