Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAB0838 (SAB0838)

This Recombinant Staphylococcus aureus UPF0344 protein SAB0838 (SAB0838) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAB0838

UniProt

Q2YWW2

Expression Region

1-129

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLMLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PLSKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTNAP2 Protein Vector (Mouse) (pPM-C-HA)
16521024 500 ng

CNTNAP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NDUFA10 Rabbit Polyclonal Antibody
orb589071 100 µL

NDUFA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OCT6 Rabbit Polyclonal Antibody (Cy7)
orb1013686 100 µL

OCT6 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Grin3a (NM_001198583) Rat Untagged Clone
RN217485 10 µg

Grin3a (NM_001198583) Rat Untagged Clone

Sign In for Pricing
View Details
Villin (VIL1) mouse monoclonal antibody, clone 3F392, Purified
AM08413PU-N 50 µL

Villin (VIL1) mouse monoclonal antibody, clone 3F392, Purified

Sign In for Pricing
View Details
OMA1 Antibody
C48121-01 50 μL

OMA1 Antibody

Sign In for Pricing
View Details