Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAB0838 (SAB0838)

This Recombinant Staphylococcus aureus UPF0344 protein SAB0838 (SAB0838) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAB0838

UniProt

Q2YWW2

Expression Region

1-129

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLMLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PLSKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DRP2 Antibody [Allophycocyanin]
NBP3-05842APC 0.1 mL

Rabbit Polyclonal DRP2 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Anti Mouse CD3E Flow Cytometry Monoclonal Clone 1452C11 AF488 25ug
IHMAAMSCD3E1452C11CAF48825UG 25 µg

Anti Mouse CD3E Flow Cytometry Monoclonal Clone 1452C11 AF488 25ug

Sign In for Pricing
View Details
Trappc6b Mouse siRNA Oligo Duplex (Locus ID 78232)
SR403437 1 Kit

Trappc6b Mouse siRNA Oligo Duplex (Locus ID 78232)

Sign In for Pricing
View Details
Clarin 2 (CLRN2) (NM_001079827) Human Over-expression Lysate
LS645104 100 µg

Clarin 2 (CLRN2) (NM_001079827) Human Over-expression Lysate

Sign In for Pricing
View Details
PcDNA3-HA-hsp90α (1-401aa)
PPL00023-2e 1 Each

PcDNA3-HA-hsp90α (1-401aa)

Sign In for Pricing
View Details
TRIM5 Polyclonal Antibody
RD88782A-01 60 μL

TRIM5 Polyclonal Antibody

Sign In for Pricing
View Details