Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAR0931 (SAR0931)

This Recombinant Staphylococcus aureus UPF0344 protein SAR0931 (SAR0931) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAR0931

UniProt

Q6GIB9

Expression Region

1-129

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Thio-dTTP
B8100-.1 100 µL (100 mM)

2-Thio-dTTP

Sign In for Pricing
View Details
Snrpe Mouse qPCR Primer Pair (NM_009227)
MP215561 200 Reactions

Snrpe Mouse qPCR Primer Pair (NM_009227)

Sign In for Pricing
View Details
C1orf195 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-15053R-BF750 100 µL

C1orf195 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Trafficking Protein, Kinesin Binding 2 (TRAK2) Antibody
abx116144 100 µL

Trafficking Protein, Kinesin Binding 2 (TRAK2) Antibody

Sign In for Pricing
View Details
NDST1 Antibody, FITC conjugated
A29499-50UG 50 µg

NDST1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Methyl 3-methoxy-5-methylpicolinate
NAC06232-01 50 mg

Methyl 3-methoxy-5-methylpicolinate

Sign In for Pricing
View Details