Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAS0839 (SAS0839)

This Recombinant Staphylococcus aureus UPF0344 protein SAS0839 (SAS0839) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAS0839

UniProt

Q6GAV7

Expression Region

1-129

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHIC2 Rabbit Polyclonal Antibody
TA374739 100 µL

CHIC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alogliptin-13Cd3
TRC-A283968-10MG 10 mg

Alogliptin-13Cd3

Sign In for Pricing
View Details
Puberulic Acid
TRC-P196705-5MG 5 mg

Puberulic Acid

Sign In for Pricing
View Details
RIT1 (NM_006912) Human Recombinant Protein
TP320552M 100 µg

RIT1 (NM_006912) Human Recombinant Protein

Sign In for Pricing
View Details
IL8 (CXCL8) Mouse Monoclonal Antibody [Clone ID: I8-61]
AM09177AF-N 500 µg

IL8 (CXCL8) Mouse Monoclonal Antibody [Clone ID: I8-61]

Sign In for Pricing
View Details
CLIC2 (NM_001289) Human Recombinant Protein
TP720238M 50 µg

CLIC2 (NM_001289) Human Recombinant Protein

Sign In for Pricing
View Details