Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAS0839 (SAS0839)

This Recombinant Staphylococcus aureus UPF0344 protein SAS0839 (SAS0839) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAS0839

UniProt

Q6GAV7

Expression Region

1-129

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: bilateral
CR562481 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
DMAC2 (NM_001167870) Human Over-expression Lysate
LC432605 20 µg

DMAC2 (NM_001167870) Human Over-expression Lysate

Sign In for Pricing
View Details
Quiescin Q6 (QSOX1) (NM_002826) Human Over-expression Lysate
LY401002 100 µg

Quiescin Q6 (QSOX1) (NM_002826) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgG Immunoglobulin (ICO-97), CF488A conjugate, 0.1mg/mL
BNC880758-500 1x 500 µL

Human IgG Immunoglobulin (ICO-97), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD133 (PROM1) Mouse Monoclonal Antibody [Clone ID: OTI5B12]
CF813575 100 µg

CD133 (PROM1) Mouse Monoclonal Antibody [Clone ID: OTI5B12]

Sign In for Pricing
View Details
TRAF5 Rabbit Polyclonal Antibody
TA363720 100 µL

TRAF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details