Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SA0830 (SA0830)

This Recombinant Staphylococcus aureus UPF0344 protein SA0830 (SA0830) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SA0830

UniProt

Q7A6H2

Expression Region

1-129

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rerg Mouse Gene Knockout Kit (CRISPR)
KN514672 1 Kit

Rerg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NEDD8 Recombinant Rabbit Monoclonal Antibody [JF69-09]
ET1702-84 100 µL

NEDD8 Recombinant Rabbit Monoclonal Antibody [JF69-09]

Sign In for Pricing
View Details
Deacetyl Racecadotril
TRC-D198995-10MG 10 mg

Deacetyl Racecadotril

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS711422 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Txnrd1 Mouse Gene Knockout Kit (CRISPR)
KN518521 1 Kit

Txnrd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cope Mouse Gene Knockout Kit (CRISPR)
KN503678 1 Kit

Cope Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details