Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SA0830 (SA0830)

This Recombinant Staphylococcus aureus UPF0344 protein SA0830 (SA0830) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SA0830

UniProt

Q7A6H2

Expression Region

1-129

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAP1 Human Gene Knockout Kit (CRISPR)
KN400090 1 Kit

RPAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS508838 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF640R conjugate, 0.1mg/mL
BNC402434-100 1x 100 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS804826 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Benzyl 2-Acetamido-4,6-O-benzylidene-2-deoxy-a-D-glucopyranoside
TRC-B211000-2G 2 g

Benzyl 2-Acetamido-4,6-O-benzylidene-2-deoxy-a-D-glucopyranoside

Sign In for Pricing
View Details
Recombinant CD127 Antibody
RC-16070-01 50 μL

Recombinant CD127 Antibody

Sign In for Pricing
View Details