Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Protein CrcB homolog 2 (crcB2)

This Recombinant Brucella suis biovar 1 Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8FZV0

Expression Region

1-129

Origin

Brucella suis biovar 1 (strain 1330)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPLDVMWVGLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVD WHDRYGTMLNAGVLTGILGGYTTFSSMQLDAVKLSHKGQGGLAVFYLVASVLSGLFAAWL DAMLAHLQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-500 1x 500 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), 0.2mg/mL
BNUB0630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), 0.2mg/mL

Sign In for Pricing
View Details