Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis Protein CrcB homolog (crcB)

This Recombinant Oceanobacillus iheyensis Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q8EMX2

Expression Region

1-129

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNVLIVMLGGFIGANLRYWLGEWMSSSSGFPTGTFVINAIGCFLLGWLLTYSEKNRLLS KEWSLLLGTGLIGSFTTFSTFSVETLLLIESAKYIVASLYVFGSIFLGIGLAYIGVRLAL YCKKEEDIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF647 conjugate, 0.1mg/mL
BNC472137-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF647 conjugate, 0.1mg/mL
BNC470280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL
BNC402312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF640R conjugate, 0.1mg/mL
BNC401553-100 1x 100 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details