Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase protein I (atpI)

This Recombinant ATP synthase protein I (atpI) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P12983

Expression Region

1-129

Origin

Vibrio alginolyticus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAALARPGRELARQLLMIQSGAVIFVAAGMAVAINPDWGFSALIGGGIFVVANAVFALC AFMFSGARAAKRIAASFYTGEVLKILITVALFYVAYMYMQVELVPLKLTYLLVLGINICA PVLFINNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XKR6 Human Gene Knockout Kit (CRISPR)
KN416120 1 Kit

XKR6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-19185-01 20 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-19185-02 60 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-19185-03 120 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJA4 Polyclonal Antibody
E-AB-19185-04 200 µL

DNAJA4 Polyclonal Antibody

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF594 conjugate, 0.1mg/mL
BNC941295-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details