Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase protein I (atpI)

This Recombinant ATP synthase protein I (atpI) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P12983

Expression Region

1-129

Origin

Vibrio alginolyticus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAALARPGRELARQLLMIQSGAVIFVAAGMAVAINPDWGFSALIGGGIFVVANAVFALC AFMFSGARAAKRIAASFYTGEVLKILITVALFYVAYMYMQVELVPLKLTYLLVLGINICA PVLFINNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFXANK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C10]
TA504261BM 100 µL

RFXANK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C10]

Sign In for Pricing
View Details
Purified Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185A-01 25 µg

Purified Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Purified Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185A-02 100 µg

Purified Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
APOBEC1 (NM_001644) Human Over-expression Lysate
LY400620 100 µg

APOBEC1 (NM_001644) Human Over-expression Lysate

Sign In for Pricing
View Details
Deoxybenzoin Oxime
TRC-D232250-250MG 250 mg

Deoxybenzoin Oxime

Sign In for Pricing
View Details
RGS18 Antibody
KC-712-01 50 μL

RGS18 Antibody

Sign In for Pricing
View Details