Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase protein I (atpI)

This Recombinant ATP synthase protein I (atpI) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P12983

Expression Region

1-129

Origin

Vibrio alginolyticus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAALARPGRELARQLLMIQSGAVIFVAAGMAVAINPDWGFSALIGGGIFVVANAVFALC AFMFSGARAAKRIAASFYTGEVLKILITVALFYVAYMYMQVELVPLKLTYLLVLGINICA PVLFINNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein
TP310483M 100 µg

MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein

Sign In for Pricing
View Details
5-Nitrothiophene-2-carboxaldehyde
TRC-N565510-5G 5 g

5-Nitrothiophene-2-carboxaldehyde

Sign In for Pricing
View Details
Double Beam UV Visible Spectrophotometer BSDBU-201-C
BSDBU-201-C Each

Double Beam UV Visible Spectrophotometer BSDBU-201-C

Sign In for Pricing
View Details
Iron(III) Oxide
TRC-I775210-5G 5 g

Iron(III) Oxide

Sign In for Pricing
View Details
5,8-Epoxy-13-cis Retinoic Acid (Mixture of Diastereomers)
TRC-E589820-2.5MG 2.5 mg

5,8-Epoxy-13-cis Retinoic Acid (Mixture of Diastereomers)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD56/NCAM Antibody[B-A19]
E-AB-F1305H-01 20 Tests

PE/Cyanine7 Anti-Human CD56/NCAM Antibody[B-A19]

Sign In for Pricing
View Details