Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Protein CrcB homolog (crcB)

This Recombinant Helicobacter pylori Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

B5Z8M0

Expression Region

1-130

Origin

Helicobacter pylori (strain G27)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNIIGCFVIGFMGHLATK KVFGDDFGIFFVTGVLGGFTTFSSYGLDTLKLLQKSQYIEAISYVLGTNLLGLIGVAIGW FLAKNFVGVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF594 conjugate, 0.1mg/mL
BNC942085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF405S conjugate, 0.1mg/mL
BNC041492-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details