Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Protein CrcB homolog (crcB)

This Recombinant Helicobacter pylori Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

O25823

Expression Region

1-130

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNIIGCFVIGFMGHLAVK KVFGDDFGIFFVTGVLGGFTTFSSYGLDTLKLLQKSQYIEAVSYALGTNILGLTGVAIGW FLAKNFVGIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-100 1x 100 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF647 conjugate, 0.1mg/mL
BNC472957-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF640R conjugate, 0.1mg/mL
BNC401680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details