Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides ethenogenes Protein CrcB homolog (crcB)

This Recombinant Dehalococcoides ethenogenes Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q3Z6F1

Expression Region

1-130

Origin

Dehalococcoides ethenogenes (strain 195)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEILLLAAGGALGAVSRYGLNNLTVKLLGDSFPYGTLIVNCLGCFVLGFLMQWGFSSDS HNTHLKLMLTAGFLGAFTTFSTFSYETLDCFKNGDYFNGFSNILANVLLGLLMVFIGAYL GSLLKQNSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/777), CF740 conjugate, 0.1mg/mL
BNC740777-500 1x 500 µL

Chromogranin A (CHGA/777), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details